PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000189394
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 204aa    MW: 24169.9 Da    PI: 7.4621
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000189394genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.92.4e-50451702128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                    +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++ 
  MDP0000189394  45 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSENF 139
                    79***************************.89***************888889******************************************* PP

            NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                    + +glkktLvfy+g+apkg +t+W+m+eyrl
  MDP0000189394 140 RSIGLKKTLVFYSGKAPKGLRTSWIMNEYRL 170
                    *****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-5344179IPR003441NAC domain
PROSITE profilePS5100551.32144188IPR003441NAC domain
PfamPF023652.0E-2546170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MAIAATRTTT SSSSTMSHDD SNKADHDHDH EHDEHVDEHE HDMVMPGFRF HPTEEELVEF  60
YLRRKVEGKR FNVELITFLD LYRYDPWELP AMAAIGEKEW FFYVPRDRKY RNGDRPNRVT  120
TSGYWKATGA DRMIRSENFR SIGLKKTLVF YSGKAPKGLR TSWIMNEYRL PHHETERYQK  180
ALRDFFFLNL PRAXGTSRVL MVSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-54301703142NAC domain-containing protein 19
4dul_A1e-54301703142NAC domain-containing protein 19
1ut7_B1e-54301703142NO APICAL MERISTEM PROTEIN
1ut7_A1e-54301703142NO APICAL MERISTEM PROTEIN
1ut4_B1e-54301703142NO APICAL MERISTEM PROTEIN
1ut4_A1e-54301703142NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008352818.11e-133PREDICTED: NAC domain-containing protein 55-like
RefseqXP_008368167.11e-133PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9FIW52e-61NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A0B2P2K81e-106A0A0B2P2K8_GLYSO; Putative NAC domain-containing protein 94
TrEMBLK7MJ701e-106K7MJ70_SOYBN; Uncharacterized protein
STRINGGLYMA17G00650.21e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72033146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.16e-98NAC domain containing protein 35